SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029686 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029686
Domain Number 1 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 157-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 74-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 397-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 35-87
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 447-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000286
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 204-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000101
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 120-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029686   Gene: ENSMODG00000028531   Transcript: ENSMODT00000031259
Sequence length 490
Comment pep:novel chromosome:BROADO5:4:413856418:413857890:1 gene:ENSMODG00000028531 transcript:ENSMODT00000031259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNSVEKSEKPGVTFGAFHLYSFQKSTNMYTGEKFYKCPQCRKAFNKSSKLILHQRIHV
GENPYECNDCGKRFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKP
FKCHDCGKAFIHTSHLLQHQRIHTDEKPFQCHDCGKAFNQNSHLLQHQRIHTGEKPFQCH
DCGKAFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRSSHLLQHQRIHTGEKPFQCHGTEK
AFNQNSNISIHQRIHNIERLFKCNDCGKAFKQSSHLLQHQRIHTGEKPFQCHDCGKAFNQ
NSNLSVHQRIHTGEKPFQCHDCGKAFNQNSHLLRHQRIHTGEKPFKCNDCGKAFNQSSHL
FQHQRIHTGEKPFKCDDCEKAFNQNSHLLQHQRIHTGEKPFKCNDCEKAFNGSSTLLKHQ
RIHTGEKPFKCNDCGKAFNQNSHLLQHQRIHTGEKPFQCHDCGKAFNQSSNLFQHQRIHT
GKLIKKSSMW
Download sequence
Identical sequences F6X255
ENSMODP00000029686 ENSMODP00000029686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]