SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029693 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029693
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 650-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 454-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 45-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 9 Region: 691-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 10 Region: 761-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 11 Region: 803-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 12 Region: 227-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000194
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 13 Region: 416-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000311
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 612-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000318
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029693   Gene: ENSMODG00000023380   Transcript: ENSMODT00000031266
Sequence length 859
Comment pep:novel chromosome:BROADO5:3:526592904:526678544:1 gene:ENSMODG00000023380 transcript:ENSMODT00000031266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETNFEVKEMSTKLRHFVEGSGSQRFMNGVPHDFILREICDSDIQGSLTFRDVTVDFTQ
EEWCLLDHSQKELYVEVMLENVQNLLSVGLPVPREYCASYFQQRKAPWLLEQKGPRSSSP
EICDSDMKINKNLKSECEFDDRSEKFSHCSVLNQYMKVASGNDSCRESQYSKCFPEEVGT
FQWNEKSSEKPIYQANLGGMAFSYSLDFIRLQKSKWIEMVSVKEEVEKPFNPNSNLAAHQ
IIDSGEKPYECKQCGKAFKQRVSLVVHHRIHSGEKPYECKQCGKAFTERGSLTRHQRIHT
GEKPYECKLCGKAFMQSSYLAIHQRIHTGEKPYECKLCGKAFMQSSNLATHQKIHTGEKP
YECKQCGKTFMQSYNLATHQRIHTGEKPYECKQCGKAFRRSSSLATHQLIHSGERPYECK
HCGKAFRGRGSFNRHQRIHTGEKPFLCKQCGKAFLEKGILIKHQLIHTGEKPFVCKQCGK
AFTYRGSLAKHQKIHTGEKPYECKHCGKAFTQGGSLTRHQKIHTGEKPYECKLCGKAFMQ
SSNLTAHQKIHSGEKPYECKQCGKAFIERRSLAKHQRIHTGEKPYECKQCGKAFTRSSSL
ATHQLIHSGERPYECKHCEKAFTERRSLAKHQRIHTGEKPFVCKQCGKAFLEKGILIKHQ
LIHTGEKPFVCKQCGKAFTYRGSLTRHQKIHTGEKPYECKQCGKAFPERGYLTKHQRIHT
GEKPFVCKQCGKAFTFIGSLAKHRRIHTGENPHEFKQCGMTFPHSRSLATHQLMHIGTKT
YECKQCGKAFTFIGSLAKHRRIHTGEKPYECKRCGKAFTQRSHLARHQLIHTGEKPHECR
HCGKSFKEKGSLVVHHRIH
Download sequence
Identical sequences F6WMI3
ENSMODP00000029693 ENSMODP00000029706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]