SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029716 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029716
Domain Number 1 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.58e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-24
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 654-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 698-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-17
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029716   Gene: ENSMODG00000023383   Transcript: ENSMODT00000031287
Sequence length 761
Comment pep:novel chromosome:BROADO5:3:526514267:526524156:1 gene:ENSMODG00000023383 transcript:ENSMODT00000031287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLLTFKDIAVDFTQEEWCLLDHSQKELYLEVMLENVQNLLSVGKDHFHLVRRSILGQKVC
YSKAETNFEVKEMSTELRIFVQESDPKSWINDGSHDFVLREVSDSDVKINKNLKSECEFD
EKFSQCSVLNQYIKVISGTDYCQDSQYSKCFPEEVGLFQLNENPSEKPIYQGNLGGMIFG
CSLDFIGHPKSKWVEMVSVKDEVENSFSQNSDLHAHQIIHLGEKPYECKQCGKAFKQRGS
LAVHHRIHSGEKPYECKECGKAFTQRSHLNKHQRIHSRKNPYECKHCGMAFTQRSHLAAH
QSIHTGEKPYECKQCGKAFTQRSHLAAHQRFHTEVKPFECKQCGKAFTQNGDLTKHQRIH
TGEKPYECKHCGKTFTQSGGLTKHQRIHTGEKPYECKHCGKAFRERGTLTKHQRIHTGEK
PYQCKQCGKAFPRSRSLAMHQLIHSGEKPYECKQCGKTFRGRGSLVIHHRIHSGEKPYEC
KQCGKAFTQRHHLAVHQSIHSGEKPYECKQCGKAFTRSRSLATHQLIHTGEKPFECKHCG
KAFTERKSLAIHQRIHTGEKPYECKHCGKAFTQSGDLAIHQRIHTGEKPYECKHCGKAFT
QRRDLTIHQRIHTGEKPYQCKHCGKAFPRSRSLALHQLIHTGEKPYECKQCGKTFRGRGS
LVVHHRIHSGEKPYECKQCRKAFTQRIHLAVHQRIHSGEKPYECKQCGKAFTRSRSLATH
QLIHTGEKPYECKQCRKAFTQKIHLAAHQRMHTGEKPHECK
Download sequence
Identical sequences F6U697
ENSMODP00000029716 13616.ENSMODP00000029716 ENSMODP00000029716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]