SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029737 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029737
Domain Number 1 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 589-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 633-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.6e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 126-169
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-18
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 214-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000117
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029737   Gene: ENSMODG00000023388   Transcript: ENSMODT00000031308
Sequence length 694
Comment pep:novel chromosome:BROADO5:3:526237061:526429747:-1 gene:ENSMODG00000023388 transcript:ENSMODT00000031308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKSWHLPLWHPQGILGILRLDSLRSWKVHSCGFWTHFLGVQRGSLPTLGLPLPEGSQC
GSSRDPRTRGNSSQDPEDPIPEAETNFEVNEMSTKLRLFVEGSGPQRCMNEVPHDFILSE
ICDSDIQGSLTFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNLLCVVLRKICEKNLR
GGKEDSTERIEERSNMGHPNIKWVEMVSVKDEGGKPFSQNSDLAADQISHSGEKPSECKQ
CGKTFKRRDSLATFPRSSSLATHQLIHSGEKPYECKHCGKAFTQRSHLAAHQSIHTGEKP
YECKQCGKTFKRRESLAKHHRIHSGEKPYECKQCGKTFPHSSSLAIHQLIHSGEKPYECK
HCGKGFTQSSHLAAHQTIHTGEKPYECKQCGKAFTQRGNLAKHQRIHTGEKPYECKQCGK
AFTEKQSLAKHQRMHSGRKPYECKHCGKAFTCSSSLVIHQLIHIGENPYKCKQCGKAFTH
SSSLASHQLIHSGEKPYECKQCGKTFKRKDTLAVHHRIHSGEKPYECKQCGKAFTRSSSL
ATHQLIHSGEKPYECKQCGKDFKHSRSLAAHQLIHTGEKPYECKHCGKAFTERGFLNRHE
KIHTGEKPYECKQCGKAFTERGYLVKHQRIHTGEKPYECKQCGKAFTERGSLANHQRIHT
GEKPYECKQCGKAFTERRSLASHQRIHTGEKPFE
Download sequence
Identical sequences F6TQG9
ENSMODP00000029737 ENSMODP00000029737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]