SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029760 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029760
Domain Number 1 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.46e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.98e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 31-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 11 Region: 153-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029760   Gene: ENSMODG00000023397   Transcript: ENSMODT00000031331
Sequence length 700
Comment pep:novel chromosome:BROADO5:3:525301485:525356736:-1 gene:ENSMODG00000023397 transcript:ENSMODT00000031331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELHQMDSLLCCLYREPGASGMAFESDRLPAQEVVTFKDVVVEFTREEWCLLSPAQKEL
FKEVMLENAWNLHSLGLPAPLEDMISYLKLKEPPWMLEQEGLRSFFPEGKIRLEIKANPT
EVSLPVEEMGLQNFMSGGLDNFAFREFCVAPQNSIHVEHQRMHTEKMSSECNQCGKSFMH
RACLAGHQRMHSDERPYECNQCGKTFPHYFNFAIHQRIHTEDKLYECKQCRKTFSKSSSL
AIHQRIHTGDKPYECKQCGKTFSRSSNLGFHQRIHTVKKPYECKHCGKKFSRSSNLGIHE
RIHTGEKPYECKQCGKTFSRRSNLGIHGRIHTGEKPYECKHCGKTFTQRSALAVHERIHT
GEKPYDCKQCGKTFLQISSLAIHERTHTGEKPYECKQCGQTFSTGSSLSEHQRIHSGERP
YECNQCGKTFTHYSNFAVHQRAHNGERPYECDQCGKTFVRSSYLAVHHRIHTGEKPYECK
QCGKTFNRSSSLTVHQRIHTGDKPYECKQCRKTFITSSSLTVHQRIHTGEKPHECKQCGK
TFTQISSLAFHERTHTGEKPYECKQCGKTFMQISALAVHQRTHTGEKPYECKQCGQTFSQ
SFRLAEHQRIHTGEKPYECKQCGKTFSRSSNLGVHQRTHTGDKPYECKQCGKTFSRSSSL
AVHERTHTGEKPYECKQCGKTFSRSSSLAIHRRIHTGEEP
Download sequence
Identical sequences F6T9E9
ENSMODP00000029760 ENSMODP00000029760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]