SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029772 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029772
Domain Number 1 Region: 95-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 37-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 18-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000202
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029772   Gene: ENSMODG00000023400   Transcript: ENSMODT00000031343
Sequence length 156
Comment pep:novel chromosome:BROADO5:3:524982024:524987518:1 gene:ENSMODG00000023400 transcript:ENSMODT00000031343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGQRCHMCEAICLFSSSQQCGKTFSHSSSLCVHERIHTGNKPYECKKCGKSYSQKSHLAV
HQRMHTGEKPYECKQCGKSFRLSCTFAQCRRTLSTNFRLAIHQRTHTGEKPYECKQCGKA
YSRRYSLAVRQRTHTGEKPYECKHCGKAFTNNSSFV
Download sequence
Identical sequences F6T8Y7
ENSMODP00000029772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]