SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029810 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029810
Domain Number 1 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 564-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-21
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 7 Region: 47-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-16
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000161
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029810   Gene: ENSMODG00000023430   Transcript: ENSMODT00000031380
Sequence length 623
Comment pep:novel chromosome:BROADO5:4:412217230:412256431:1 gene:ENSMODG00000023430 transcript:ENSMODT00000031380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKICSLWVHKEEVSPTWDSHPLKDHSMAQAEALESEGMAPSTQRPPSQGLITFKDVAVD
FTQEEWCLLDHAEKELFLEVMQENVQNLLFVEAEVNFELKGISSKLSLFVEESGPQRVIN
EDPCDFILREICDSNMKVNKNPESDCEFDKIAEKFSQYSVLNQYMKRTSGNDHCHDRECS
KCFLEDVGLIQLHEKPPEIPMAQGNLVGSGFGCSLALIRHIKNKHVEILSVSNKVGRAFS
QNSERVSYQIIHSGENSYARKQGGKAFTEKRYLFAHERIHTGEKPYACKQCGKTFTRRGD
LGKHQRIHTAENPYECTQCRKAFTKRSHLSAHQRIHTREKPYSCKQCGKAFSEKTYLISH
QRIHTEEKPYSCKQCGKAFTQRGNLVAHQRIHTGEKPFECKQCGKAFTQRGHLAAHQRIH
TGEKPYKCKQCGKAFTERGHLVAHQRIHTGEKSYECKQCGKTFTQRSNLAKHQSIHTGEK
PYACKQCVKTFIERGHLAAHQRIHTGEKPYECKQCGKAFTKRGHLAVHQRIHTAEKPYEC
TQCGKAFTQRGHLAAHQRIHTGEKPYECKQCGKTFTQRSHLATHQSIHTGEKPYECTQCG
KAFTQRSHLAAHQRIHTGETLCM
Download sequence
Identical sequences F6X116
ENSMODP00000029810 ENSMODP00000029810 XP_016277915.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]