SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029822 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029822
Domain Number 1 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 9-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 201-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-18
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029822   Gene: ENSMODG00000028606   Transcript: ENSMODT00000031392
Sequence length 597
Comment pep:novel chromosome:BROADO5:4:411619561:411789795:-1 gene:ENSMODG00000028606 transcript:ENSMODT00000031392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWTPRPPSQGSITFKDVAVDFTPEEWCLLDHAQKELYKKVMLENVQNLLFVEAETNIE
VKNMSPKLNLFVEGSGLSRGMNKDLCDFILREICDFNINVNKNRKSDCKFDEITEKFSHH
SVLNQYMKVTSGSNYCQDSEYTKCFLEKVGFEQFHVKPPEMPMYQGNLGRIAYGSSLDLR
RHPKSKHVEMLSVNNKGVRPFSQNSELGSCQIIHSGKRPYECKRYGKTFTQRGNLAAHQR
IHTGNKSYECKQCRKTFIRRDHFALHQKIHTGEKPYLCIQCGKAFTERGSLAAHQRIHTG
EKPYECKQCGKAFTEKGHLAKHQRIHTGEKPFECKQCGKAFTVQDNLAVHQRIHTGEKPY
ECKQCGKAFAVKGNLTVHQRIHSGEKPFECTQCGKAFTDKGSLAKHQRIHTGEKPYECTL
CGKAFTCRGDLHKHQKIHTGVKSYECKQCGKAFTEKGSLAAHQRIHTGEKPFECTQCGKA
FTERGNLAKHQRIHTGEKPFECIQCGKVFTVRGSLAKHQRIHTGEKPFECKQCGKAFTVR
GSLARHQRIHTGEKPFECIQCGKAFTRSGHLAAHQSIHTGEKPHKCTQRGKAFTHRI
Download sequence
Identical sequences F6WKS6
ENSMODP00000029822 ENSMODP00000029822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]