SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029823 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029823
Domain Number 1 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.08e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-21
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 122-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 263-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000463
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029823   Gene: ENSMODG00000023432   Transcript: ENSMODT00000031393
Sequence length 400
Comment pep:novel chromosome:BROADO5:4:411588506:411601915:-1 gene:ENSMODG00000023432 transcript:ENSMODT00000031393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSITFKDVAVDFTQEEWCLLDHSQKELYREVMLENVQNLLSLGLSFLAPEIVSLLQEGKE
YPTFVIPEDIPESLWAISSSDVGLLKHLKSKHVEILSVSNKGVRPFSRNSELGSYQIHSR
ERPYECKQCGKAFTERGYLPAHQRIHTGEKPHECKQCGKAFTQRSNFVRHQRIHTGEKPY
ECKQCGKTFKQRSHLARHQKIHSGVKPYECKQCGKTFKQRSHLAGHLKIHTGEKPYECTL
CGKAFTWSSDLAKHQRIHTGEKPYECKQCGKTFTRSGHLATHHRIHTGDKPYECKQCGKT
FKRHSHLAVHQKIHSGVKPYECKQCGKAFTWRSDLAKHQRIHTGEKPYECTECGKTFTER
GTLVVHQRIHTGEKPFECKQCGKAFVHRASLVAHQRIHTG
Download sequence
Identical sequences F6WKR9
ENSMODP00000029823 ENSMODP00000029823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]