SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029843 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029843
Domain Number 1 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-26
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 11-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029843   Gene: ENSMODG00000007375   Transcript: ENSMODT00000031413
Sequence length 664
Comment pep:novel chromosome:BROADO5:3:523862074:523871375:1 gene:ENSMODG00000007375 transcript:ENSMODT00000031413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGPPRPGAPQGMVTFRDVAVIFSPGEWRLLDPPQKQLYREVMLENYRTLVWLGFVGAK
PEVISHLEQGDAPWVPEDPFPSGSCTDRDTERHTNEPTPKLHHSKGKLYQKKISGGGHSI
SELQKGSKYARSKKEHNKEQGFTLGKIKKGKPHNQMRGHKYFKNSKKSNLEAGLFPQREV
SIGKKLHKLDTQRKNFRLSSVLKKYNRGCRRKIDSNDTEGKQSLNYNFHLTKKHRIHTRE
KVYECHECGKTFHQNTYLQKHQRVHTGEKSYACKECGKTFLRSSELTRHQRIHTGEKPYE
CNECGKAFRSKSHLTEHQRIHTSEKPFACEECGKAFLRRTDLKQHQRIHTGERPFECNEC
GKAFRQSSYLRRHERIHTGEKRYECKICGKAFLRATEVTLHQRTHTGEKPYECNECGKTF
RWKTHLTEHQRTHTGEKPHVCNYCGKAFLRSTNLIQHQRIHTGEKPYKCNECGKAFCQRS
DLVQHKRIHTGEKPYKCSECGKAFSQKTALNQHNRIHTGEKPYVCSDCGKAFQWSTVLVR
HRRTHTGEKPYGCSECGKSFSQKAKLIRHQRIHTGEKPFECNECKKAFSRKADLTIHYRK
HTGEKPYKCNECGKAFRYNSHLTQHQKIHTGEKPYECTECGKAFIWRTAFNQHRRIHTGE
KTDE
Download sequence
Identical sequences F6W4W7
XP_007490773.1.35504 ENSMODP00000029843 ENSMODP00000029843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]