SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029852 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029852
Domain Number 1 Region: 612-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 556-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.97e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 6 Region: 445-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.12e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 11-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 10 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-16
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000029852
Domain Number - Region: 181-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0176
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029852   Gene: ENSMODG00000023435   Transcript: ENSMODT00000031422
Sequence length 770
Comment pep:novel chromosome:BROADO5:4:411280877:411303488:1 gene:ENSMODG00000023435 transcript:ENSMODT00000031422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGSGTASLEVVTFRDVAVDFTQEEWGCLEPWQKQLYREVTLDNYRNLLSLAGLPGPG
ADVISQVERGETPGELPGGGTDWEARPETIESPPKMAISMDESLQESHSCDSHWDFKLEE
GWEYNAKLETKQKNQDYHSRSLKVTSQKTLPEGQSDECHKFGGNFSLESFISLQQKGPVR
ESQHECHTDEKNFRQYSNLVKHTEINSDNALSNYNKWRKCFGYQSDLTHFHQKSTAKRIY
ENNQCEKAITWNTDLIGHQKIHIGEKPYKCNECGKAFSQSTKLIYHQKIHTGEKPHKCNE
CGISFMHHSSLTYHQRFHTGEKAYECNQCGKAFSWSTDLIRHQRIHTGEKPYKCNECGKA
FIQNTKLIYHQKIHTGEKPHKCNECGTAFIHHSSLTYHQRVHTGEKPYECNQCGKAFRRS
TDLIRHQKIHTGEKPYKCNICGKDFTQSSSLTVHQRIHTGEKPHKCNECGKAFSEHSSLI
CHQRIHTGEKSYECNQCGKAFRQSANLTVHQRIHTGEKPHECNECGKTFIQHSSLIYHQR
IHTGEKSYECSDCGKAFRRSTDLIRHQKIHTGEKPYKCNECGKAFIRSSSLSVHQRIHTG
EKPYECSHCGQAFSWSRDLIRHQNIHTGEKPFKCNECGKAFTRSSSLTVHQRNHTGEKPY
ECNQCGKGFSRSTELIRHQKIHTGEKPYKCNQCGKAFSWSTDLIRHQKIHTGEKPYKCNE
FNPIPFNEHLLAYFMQSTMLDNGDPKTEMMQSLTSANLHSIGRNSMYPNN
Download sequence
Identical sequences F6W4K3
ENSMODP00000029852 ENSMODP00000029852 XP_007492681.1.35504 XP_016278221.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]