SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029872 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029872
Domain Number 1 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.64e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 9-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 9 Region: 85-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-17
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029872   Gene: ENSMODG00000023439   Transcript: ENSMODT00000031442
Sequence length 517
Comment pep:novel chromosome:BROADO5:3:523514783:523533894:-1 gene:ENSMODG00000023439 transcript:ENSMODT00000031442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFERDRLPAQEAVTFKDVAVDFTWEEWRLLSPPQKLLYKEVMLENARNLLSVEVSLPME
EMDLQRFMSYGPDNFTFREFCVVPQNSSHIEHQRIHTQEKSNESNQCRKTFMLRTNLAGH
QRIHTGERPYECKECGKTYRLSSSLAVHQRIHTDEKPYKCNQCGKTFNWSSHLAVHQRVH
TGEKPYECKQCGKTFKERSKLAVHQRIHTGEKPYECKQCGKTFSRSSHLAVHQRVHTGEK
PYECKQCGKTFKERSKLVVHQRIHTGERPYECKECGKTYRLSSSFAVHQRIHTDEKPYKC
NQCGKTFNWSSNLAVHQRVHTGEKPYECKQCGKTFIQSSNLAVHQRIHTGEKPYECKQCG
KTFSRSSHLAVHQRVHTGEKPYECKQCGKTFIQSSNLAVHQRIHTGEKPYECKQCGKTFS
RSSHLAVHQRVHTGEKPYECKQCGKTFKERSKLAVHQRVHNGEKPYECKQCGKAFSQSCS
LAIHHRIHTGEKPYECKQCGKAFSQNSHLAVHQRIHT
Download sequence
Identical sequences F6W3R6
ENSMODP00000029872 ENSMODP00000029872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]