SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029881 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029881
Domain Number 1 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.95e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 32-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 640-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 11 Region: 156-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000069
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029881   Gene: ENSMODG00000023443   Transcript: ENSMODT00000031450
Sequence length 701
Comment pep:novel chromosome:BROADO5:3:523235735:523267984:1 gene:ENSMODG00000023443 transcript:ENSMODT00000031450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELHQIDSLGLLCCLYKEPGASGMTFERDTLPAQEVVTFKDVAVEFTREEWCLLSPPQK
ELYKEVMLENVQNLHSVGLPAPPEDMIYYVEQRDSSWMLEQEGLRSCCPGKIRREKKVNP
TEMSLPVEEMDLQRFMSDGPDNFSFKEFCVPSPNLSHIEHQRMHTEEKSSESNQRGKTFL
YRSNLTGHRSIHTGEKLHEFMPCGETFSKTSSLAGHQRMHPDEKPYECKQCGKTFSQRDS
LSVHQRIHTGEKRYECMQCGKTFTRSSHLAVHQRIHSGEKPYECMQCGKTFSWSDRLAVH
QRIHTGEKPYECKQCGKKFNRKGQLAVHQRMHTGEKPYECKKCGKTFSQSSHLAVHQRMH
TGEKPYQCNKCGKTFSQTSSLAGHQRMHTGEKPYQCNKCGKTFSQRDNLSVHQRIHTGEK
PYECKQCGKTFTCSSQLPVHQRIHTGEKPYECKQCGKTFSQRDNLSVHQRIHTGEKPYEC
KQCGKTFSRSDMLAVHQRMHTGEKPYECMQCGKTFARNSHLAVHQRMHTGEKPYECKQCG
KTFTCSSYLALHERIHTGEKPYECMQCGKTFARNSHLAVHQIMHAGEKPYECKQCGKTFT
CSSYLVLHERIHTGEKPYECMQCGKTFSRRGNLAVHQRIHTGEKPYECMQCGKTFARSSH
LAVHQRIHTGEKPYECKECGKKFSHTSSLSVHQRMHTGEKP
Download sequence
Identical sequences F6W3K3
ENSMODP00000029881 ENSMODP00000029881 XP_016288504.1.35504 XP_016288505.1.35504 XP_016288506.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]