SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029888 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029888
Domain Number 1 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-27
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 364-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000112
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029888   Gene: ENSMODG00000029188   Transcript: ENSMODT00000031457
Sequence length 565
Comment pep:novel chromosome:BROADO5:3:523165143:523180326:1 gene:ENSMODG00000029188 transcript:ENSMODT00000031457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELHQRDSLGPLCCLYREPRVPGMTFERDRLPAQEVVTFQDVAVDFTWEEWRLLSPPQK
ELYKEVMLENVCNLHSVGLPAPPKDVISYLEQRESSWMLEQEGLRSCYPEMRPEMKANST
EISLPVEKVDLQRFMSDGPDNFSFKEFCVTPPNSSHIEHERKHTAEKSSESNQCGKTFMH
RSSLARHQRIHIGEKRYECKQCGKTFSQSGNLAVHQKIHSGERPYECKQCGKTFSQSGNL
AGHQRIHTGEKPYKCKQCGKTFSQCSALAVHQRTHTGEKPFECKQCGKTFSCTSSLVGHQ
RIHTGERPYECKQCGKTFSLRGNLAVHQKIHTGEKPYECKQCGRTFSQCSALAVHQRTHT
GEKPFECKQCGKTFSCASSFAGHQRIHTGEKPYECKECRKTFSRSSSLVIHQKIHTGEKP
YECKQCGKTFNWGSKLAVHQRIHTGEKPYECRQCGKTFSRCSNLAVHQKIHTGEKLYECK
SCGKTFSQSSNLAVHQKIHTGEKPYECKQCGKTFSQSGNLAVHQKIHTGEKPYECKQCGK
TFRRSDNLAVHQRIHTREKPYESKL
Download sequence
Identical sequences F6VNM7
XP_007490744.1.35504 ENSMODP00000029888 ENSMODP00000029888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]