SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029889 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029889
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 419-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 468-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000507
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 159-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000085
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029889   Gene: ENSMODG00000029418   Transcript: ENSMODT00000031458
Sequence length 506
Comment pep:novel chromosome:BROADO5:3:523124018:523216101:1 gene:ENSMODG00000029418 transcript:ENSMODT00000031458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELHLMDSLGLLCCLYRDPGASGMAFERDRLPVQDVVTFKDVAVEFTQEEWCLLSPPQK
ELYKEVMLENVQNLYSVGLPAPPEDMTSYMEQRESSWMLEQEVLRSCCPEGKILPEIKAY
PIEMSLPMDEMDLQIFMSDGPDNFSFKEFFVPIPNLSDIEHQQMHTEEKSHESNQKGRTF
MYRSNLTGHQRIHTGEKPYECMHCGKTFSRRGQLTIHQRMHTGEKPYECMQCGKTFSQRG
QLTIHQRMHTGEKPYECMQCGKTFACSSHLAVHQRIHTGEKPYECMHCGKTFSQRGQLTV
HQRTHTGEKPYECKQCGKTFSKTNSLARHQKMHTWEKPYECNQCGKTFSRSDMLAVHQRI
HTGEKPHQCMQCGKTFSRRHHLAVHERMHTGEKPYECKQCGKTFARNSHLAVHERMHTGE
KPYECKKCGKTFSQISILAGHQRIHTGEKPYECKKCAKTFSQSSHLAVHQRIHTGEKPYE
CMQCGKTFSWRGQLAVHQRAHTGEKP
Download sequence
Identical sequences F6VNL8
ENSMODP00000029889 ENSMODP00000029889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]