SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029904 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029904
Domain Number 1 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 908-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 768-825
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 824-881
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 712-769
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 573-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-22
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 12 Region: 964-1019
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 13 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 14 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 15 Region: 515-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 16 Region: 1066-1118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 17 Region: 1008-1068
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000539
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 18 Region: 127-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000184
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 19 Region: 675-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000265
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 20 Region: 871-902
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000138
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029904   Gene: ENSMODG00000008577   Transcript: ENSMODT00000031473
Sequence length 1123
Comment pep:novel chromosome:BROADO5:3:522870705:522923506:1 gene:ENSMODG00000008577 transcript:ENSMODT00000031473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALERDRLPTQEAVTFKDVSVDFTREEWCLLSPPQKELYKEVMLENAQNLLSVGLPAPPE
EVVSYLEQREAPWMLEQEGLRSCPGEGGQKTWESQEVSYPVEEMDLQRFMCSNPDNFASK
EFCVARQNSSLIEHQRIHPEEKSSENNQCRNTFMHRSSLARHARIHTNKERYEWKQYGKT
FSQSSSIAGHQRMHTGENPHECKQCGKMFSQCSSLALHQRMHTGVKLYECKQCGKTFNQS
SHLVVHQRMHTGEKPYECQQCGKTFSHSSNLAVHQRMHGEKPYECQQCGKTFTRTSSVAV
HQRMHTGEKPYECKRCGKTFSHSSNLAVHQRMHTGEKPYECKQCGKTFNQSSSLAVHQRM
HTGEKPYECKQCGKTFNQSSSLAVHQRMHSGEKPYECKQCGKAFSMSSHLVVHQRMHTGE
KPYECKQCGKIFNQSSSLAVHQRMHTGEKPYECQQCGKTFTRTSSLAVHLRMHTGDKPYE
CQQCGKTFSQSSSLAVHQRMHTGDKLYECQQCGRTFTSTSRLAVHQRMHTGEKPYECNNQ
CGKTFIHRPSLAGNQRIHPGEKPYELKQCGKKFSQSFALVVHERIHTVEKPYECKQCGKP
FRYISSLDGHQRTHTGEKPYECKQCGKTFCQSSALASHQRIHTGEKPYECKQCEKTFRQS
SSLAIHRRIHTGEKPYECKKCGKTFTDKSNLSKHQRTHTGEKLYECKQCVETFSCTTKLA
AHQRIHTGEKPYECMQCGKTFSFSSSLARHQRIHIGEKLYECKQCGKTFRYISSLAGHQR
IHTGEKPYECMQCRKTFSFSSSLARHQIIHTGEKPFECKQCGKTFGYFSSLAGHQRIHTG
DKPYECMQCGKTFSFSSGLAIHQRIHTGEKPHQCKQCGKTFSCTPKLAAHQRIHTGEKPY
ECMQCRKTFRLSSSLAIHQRIHTGEKPYECKQCGKTFSFSSSLAIHQRIHTGEKPYECIQ
CGKTFSFSSSLAIHQRIHTGEKPYECKKCGKTFTEKSTLSKHQRTHTGEKLLKCKQCGKD
IQAENPIFLNIREHTRETIYECKKCVKTFHQSSILAIHQRIYTGEKSYECKQCGETFSYI
TKLAAHQRFHTGEKPHECKKCGKAFSQSFYLAAHQRIHIVEEP
Download sequence
Identical sequences F6U656
ENSMODP00000029904 ENSMODP00000029904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]