SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029909 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029909
Domain Number 1 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 626-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 794-851
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.99e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 682-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 738-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 570-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 235-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 346-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 12 Region: 836-888
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.38e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 13 Region: 405-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.22e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 14 Region: 9-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 15 Region: 123-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000216
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029909   Gene: ENSMODG00000023449   Transcript: ENSMODT00000031478
Sequence length 894
Comment pep:novel chromosome:BROADO5:4:411000893:411110140:-1 gene:ENSMODG00000023449 transcript:ENSMODT00000031478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTPRPPSQGSITFKDVVVDFTQEEWCLLDPSQKELYREVMLENVQNLFFVEEEPPKL
TPFILYLQEVHNDRKSVGSWKHPEMPMYQDKIGRITFGSSFDLRRHQNHVEILSVSNKGG
RPFSQNSEFDSYHIVHSGERPYQCKECVKAFIQRGNLVSDQRIHPGEKPYECINYGKSFT
ESGNLVIHQRIHTGEKPYECTQCGKAFTESSSLAKHQRIHTGEKPYECTQCGKPFKRRGD
LAAHQRIHTGEKPYKCTQCGKPFTQRGVLAAHQRIHSGEKPYECTQCGKAFTQRSNLVKH
QRIHTGEKPYECIHCQKAFTESSSLAKHLRIHTGEKPYECTQCGKAFIHRVSLSAHQRIH
TGEKPYECTQCGKAFTRMSDLTKHQRISTGEKPYEYTQCGKFLKQRGDLAAHLKIPTGEK
PYECTQCGKPFTQRGVLAAHQRIHSGEKPFECTQCGKAFTQRSNLVKHQRIHTGEKPYEC
TQCGKAFTESSSLAKHQRIHTGEKPYECTQCGKAFIHRVSLSSHQRIHTGEKPYKCTQCG
KAFTQRSNLVKHQRIHTGEKPYECTQCAKTFTESSSLAKHQRIHTGEKPYKCTQCGMSFI
HRVSLAAHQRIHTGEKPHECTQCGKAFIHRVSLAAHQRIHTGEKPYECTQCGKAFTQRSN
LVIHQRIHTGEKPYECTQCGKAFTDSSSLARHLRIHTGEKPYKCTQCGKAFTRRGYFVIH
QRNHTGEKPYECTQCGKAFTERSSLAMHQRIHTGEKPYECTQCGKPFICRGHLAAHQRIH
TGEKPYECAECGKAFIHKVSFAVHQRIHTGEKPYECTQCGKAFTRRGHLVIHQRIHTGEK
PYECTQCGKAFTESSSLARHQRIHTGEKPYECNHCGKAFTWRGDLAKHQRIHTA
Download sequence
Identical sequences F6U5Z3
ENSMODP00000029909 ENSMODP00000029909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]