SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029919 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029919
Domain Number 1 Region: 631-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-27
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 743-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 380-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 687-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 183-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 324-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 11 Region: 785-832
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 12 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-17
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 13 Region: 594-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000105
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 14 Region: 230-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000134
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 15 Region: 131-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000101
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029919   Gene: ENSMODG00000023450   Transcript: ENSMODT00000031488
Sequence length 833
Comment pep:novel chromosome:BROADO5:3:522733398:522741011:-1 gene:ENSMODG00000023450 transcript:ENSMODT00000031488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVKFQDVAVDFTWEEWSLMSPPQKELYREVMLENARNLLTVGKEPSPSYLSLPSKGISP
GEEAETPQEKSPGGSERCQGGRSRQEREIRPEMKLTATDLSLSVEEMNLQRFMSDCPDNF
AFREFCVAPQNSSDIEHQGIHPGGKSSEDNQCGNTFMQRAICVGYQRMHSLKKPHEWKQR
GKTFTCYSSIARHQRIHTGEKPYKCNQCGKLFSRRSSVLVHQKIHSGEKPYECNQCGKTF
HWKSSFVKHQRIHTGEKPYECKQCGKRFSRRSHLAEHQRIHTGEKPFECKQCGKRFSRRS
HLAEHQRIHTGEKPYKCNQCGKLFSHRSSVLVHQKIHSGEKPYECNQCGKTFHWKSSFVK
HQRIHTGEKPYECKQCGKRFSRRSHLAEHQRIHTGEKPFECKQCGKRFSRRSHLAEHQII
HTGEKPYECNQCGRTFSLPSLLARHQRIHTGEKPYDCIQCGKSFRLSSHYAVHQRIHTGE
KPYECNQCGKTFRRRSHLSVHQRIHTGEKPYECNQCGRTFSLRSRLARHQRIHTGEKPYE
CNQCGKTFSQSTSLAVHQRIHSGEKPYECNQCGKTFSRSSSLAEHQRIHTGEKPYECNQC
GKTFSQCSHLAVHQRIHSGEKPYKCNQCGKAFSRKSSLAVHQRIHTGEKPFECNQCGKTF
SMRSHLASHQRIHTGEKPYECNQCGKTFSMSYYLAEHQRIHSGERPYECNQCGKAFSRNS
SLAVHQRIHTGEKPYDCKKCGKTFSLHSHLARHQRIHTGEKPYECNQCGKTFNQSSYLAV
HQRLHTGEKPYECNQCGKTFSLSSYLAVHQRIHTGEKTYECKKCGKIFSQSSY
Download sequence
Identical sequences F6U517
ENSMODP00000029919 ENSMODP00000029919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]