SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029923 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029923
Domain Number 1 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 42-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 99-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 4-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 145-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000377
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029923   Gene: ENSMODG00000023451   Transcript: ENSMODT00000031492
Sequence length 509
Comment pep:novel chromosome:BROADO5:4:410784517:410786043:-1 gene:ENSMODG00000023451 transcript:ENSMODT00000031492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGERPYQCKECGKAFTQRGHLVRHQRIHSGEKPYKCTQCGKAFTESSSLARHQRIHTGEK
PYECTQCGKAFIHRESLAAHQRIHIGEKPYECTQCGKPFTRTCDLAKHQRIHSGEKPYEC
TQCGKAFTESNSLARHQRIHTGEKPYECTQCGKIFTQRGDLVRHQRIHTGEKLYECTQCG
KAFTQRGNLAKHQRIHSGEKPYECMQCGKAFTQRGNLAKHQRIHSGEKPYECSQCGKAFT
QRVNLAAHQRIHSGEKPYECTQCGKPFTRRGKLAAHQRIHTGEKPYECTQCRKAFTESSS
LARHQRIHTGKKPYECTQCGKAFIHRVSLAAHQSIHTGEKPYECTQCGKAFIHRVSLAEH
QRIHTGEKPYGCTQCGRAFSRRGDLAKHQRIHSGEKPYECTQCGKIFTVRGHLVRHQRIH
TGEKPYKCTQCGKAFTQRQYLAVHHRIHSGEKPYECTQCGKAFTRRDNLAAHQRIHSGEK
PYECTQCGKAFTHSVSLAKHQRIHTGEKP
Download sequence
Identical sequences F6TPN9
13616.ENSMODP00000029923 ENSMODP00000029923 ENSMODP00000029923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]