SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029924 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029924
Domain Number 1 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 69-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 125-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 238-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 466-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.17e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 16-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029924   Gene: ENSMODG00000005169   Transcript: ENSMODT00000031493
Sequence length 518
Comment pep:novel chromosome:BROADO5:4:410656419:410658142:1 gene:ENSMODG00000005169 transcript:ENSMODT00000031493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLEKDLINVKNVERTQKGHLVRHQRTHTGEKPYECTQCGMAFIERGKLAAHERIHTGEKP
YECTHCGKAFTRKGYLAEHQRIHTGEKPYECTHCGKAFTRRGYLAEHQRIHTGEKPYQCT
QCGKAFTDRSSLVKHQRMHTGEKLYECTQCGKAFTQRVKLAAHQRMHIGEKPYECTQCGK
AFTRKGYLTAHQRIHSGEKPYECTQCGKGFIYRMSLTVHQRIHTGEKPYECTQCGMAFIE
RGKLAAHERIHTGEKPYECTHCGKAFTRKGYLAEHQRSHTGEKPYECTHCGKAFTRRGYL
AEHQRIHTGEKPYQCTQCGKAFTDRSSLVKHQRMHTGEKLYECTQCGKAFTQRVKLAAHQ
RMHIGEKPYECTQCGKAFTRKGYLTAHQRIHSGEKPYECTQCGKGFIYRMSLTVHQRIHT
GEKPYECTQCGKAFTERSYLVKHQRIHTGEKPYECTECEKAFTQRRVNLVKHQRMHTGEK
PYECTQCGKAFTWKGYLAAHERIHTGEKPYECTQCGKV
Download sequence
Identical sequences F6TPM8
13616.ENSMODP00000029924 ENSMODP00000029924 ENSMODP00000029924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]