SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029945 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029945
Domain Number 1 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 636-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 52-112
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-21
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 678-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 220-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 11 Region: 543-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000247
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 170-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000105
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029945   Gene: ENSMODG00000023459   Transcript: ENSMODT00000031515
Sequence length 736
Comment pep:novel chromosome:BROADO5:3:522632319:522659263:-1 gene:ENSMODG00000023459 transcript:ENSMODT00000031515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERHLEVPCYSDTSPGKDGRALPDGLTGATLLPLQGACRRASGMTFERDRLPAQEAVTFQ
DVAVEFTWEEWCLLSPPQKELYKEVMLENTRNLHSVGLPAPPEDMISYMEQREFSWMLEQ
DGLSSCCPEGKIRPETKANPTEMSLPVKEMNLHGPDNFSFKEWCVPSPKLSHIEHQRMHT
KLKSSESNQRGKTFTYGSNLTGHQRIHTGEKHYERMQFSCSHHLVHQKMHIGEKPYECKQ
CGKTFSQSDMLAVYQRIHTAEKPYECMQCGKTFSRRYHLTIHQKMHIGEKPYECKKCGKT
FSHTSSLAVHQRIHTGEKPYECKECGKKFNRTCQLAVHQRMHTGEKPYECKQCGKTFSRS
DHLAVHQKTHNGEKPYECKQCEKTFSRSDHLAVHQKIHNGEKPYDCKQCGKAFSRRHHLT
VHQKMHNGEKPYKCMQCGKTFSQTSSLAGHQKMHIGEKPYECKKCGKAFCQISSLVGHQR
MHNGEKLYECMQCGKTFIYSSHLLVHQRIHTGEKPYECKQCGKTFSRSDLLAVHQRIHTG
EKPYDCKQCGKTFSRSDHLSVHQRMHTGEKPYECKKCGKTFSQISSLVGHQKMHTGEKPY
ECKKCGKTFTRSSHLALHQGIHTGEKPYECKECGKTFSQTSSLVVHQRMHTQEKPYECMQ
CGKTFTRSSHLAVHQRIHTGEKPYECKDCGKKFNQRARLAVHQRMHTGEKPYDCKQCGKA
FSRGDNLAVHQKIHIV
Download sequence
Identical sequences F6T812
ENSMODP00000029945 XP_007490731.2.35504 ENSMODP00000029945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]