SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029979 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029979
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-18
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 146-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000298
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029979   Gene: ENSMODG00000011106   Transcript: ENSMODT00000031548
Sequence length 472
Comment pep:novel chromosome:BROADO5:4:409817041:409821698:1 gene:ENSMODG00000011106 transcript:ENSMODT00000031548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFKDVAVDFSQEEWCLLDPSQKELYKDVMLEISQSLLSLAGLPVPKANVISQVDQAETP
WMLKQVDSRSSSPGDDEFNEFERNSNQDSKIHHDQAERRRSSQRYSDLFECKEITSGDGY
SKYSEHSDCLPEEMDLLEHHGVKGFQDGDCETSFGLSPNLISHQKSNAGEMSYKYREHGT
TFTQNSPLGLHQKVPPGKKSYECNQCGKAFFRNTDLSQHQKIHSAEKAYKCSECGKAFSQ
SRDLHRHQRIHTGEKPYKCNECGKAFSYSSSLIAHQRIHSGEKPYECSQCGKAFRNHSNL
AVHQRIHTGEKPYKCNECGKAFSQSRDLLRHQNIHTGEKPYKCNECEKAFSQSRDLLRHQ
NIHTRGKPYKCNECDKSFSQSTSLLTHQSIHAGERPYKCNECGKAFSRSSNLRVHQRIHT
GEKPYKCDECGKAFILKSSLILHQKVHTGEKTSKCNQRGKAFRQNFHFAAHQ
Download sequence
Identical sequences F6SR06
13616.ENSMODP00000029979 ENSMODP00000029979 ENSMODP00000029979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]