SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029982 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029982
Domain Number 1 Region: 38-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000109
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029982   Gene: ENSMODG00000023474   Transcript: ENSMODT00000031551
Sequence length 619
Comment pep:novel chromosome:BROADO5:4:409651459:409668710:1 gene:ENSMODG00000023474 transcript:ENSMODT00000031551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPTVPFKALVSQDFALLQKRRVKEEVEGVTSGRLMAGSQESVTFQDVAVDFTREEWG
HLEPAQKDLYRDVMLENYQNFVSLGLPVSQPDVISQLERGEALWLLEADVPRCTFPVSFT
QNISYETKKLIPEKSISMRESTKKKFTKDDPWHLKLEETWDCDVRLAGPKGSTERQHCRS
TGTHGKPLDELSVHEFGGKFNLVSVLPQQTDPVRKSLHKYTIEKSFEQFSGLSKHCKLSL
GKTFSKYNKCKKPFSYHSDLIQYHRTHSGEKPHKCNECGKVFSNNSCLTVHQRIHTGEKP
YKCNECGKAFSQKGNLNTHKIIHTGLKPFECNQCQKAFGNNSSLILHQRIHTGEKPFECN
VCRKAFSQRGYLKQHERIHTGERPFECNECAKTFSNSYHLTRHQSIHTRVKPYLCNECGK
AFSQQEYLKKHKRLHNGEKPFECNECGKAFSDNHQLTRHQSIHSREKPYVCKKCGQAFSN
SSRLSEHQRNHARGKPYKCDECDKDFRHSSSLVQHQRIHTGEKPFQCHECEKAFSQRGDL
NKHRRIHTGEKPFQCHECGKAFSQRKYLTEHQEIHSQEKPYKCNECGKAFSRKKYLSEHQ
GIHSRENLLDVMNVGEILA
Download sequence
Identical sequences F6SQK4
ENSMODP00000029982 ENSMODP00000029982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]