SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029994 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029994
Domain Number 1 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 413-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.13e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 594-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 224-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000137
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 515-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000353
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 10 Region: 375-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000005
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000432
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029994   Gene: ENSMODG00000029424   Transcript: ENSMODT00000031563
Sequence length 680
Comment pep:novel chromosome:BROADO5:4:409687675:409697273:-1 gene:ENSMODG00000029424 transcript:ENSMODT00000031563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYKNLVSLGLQTIKPDVISRLEQGEVPWIPTSHVPKDSSHHKTISRTKKSAPKQDLS
VRESSKKRVTKDDSQKDSKLRKVSGGNSKAEIKKEKPGKQSKNEALSHQQKHQAPKITNE
SKAHKCNTFDRKCSPVSIPTSRQSVPTATSVHKCHIARESFFKQLSELIKHSKISFGKNI
CKYNNNKQPFGSHTESTKKPEKRNEEKLGKDKCGKDNMPRKPHTEHQKSHTKNKRNRCNE
CGKTFTRSTGLSEHKKIHSGEKPFVCDQCGRAFTAKGRLNEHQKVHTGKKPYKCHECGKA
FAIRGRLNEHQKVHTGEKPYECNECGKAFIQKGTLLEHQNVHTGEKPYECKQCGKAFRQR
GQLYEHQKIHTGEKPYKCNECGKAFLGKGRLTDHKKIHLREKPHTCSECGKGFVQRSHLF
DHQKIHTGEKPYKCNHCGKAFIKKALLIGHQKIHTGVKPYECEYCGKAFTLKARLNEHLK
IHTGERPYECDQCGKGFIVKARLIEHLKIHTGEKPFKCAECGKSFTQSGQLTEHQKIHSG
LKPFKCNHCGKAFTHKGRLGEHQKIHTGEKPFECSQCGKAFTQSGQLNEHKKIHTGEKPF
ECSQCGKAFTRKERLSEHQRIHTGVIPYECSECGKAFTRKERLSEHQRIHTGAKPFECSE
CGKTFSRRTSLFYHQKTHRK
Download sequence
Identical sequences F6S879
ENSMODP00000029994 XP_007492655.1.35504 XP_007492656.1.35504 ENSMODP00000029994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]