SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030003 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030003
Domain Number 1 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-26
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 607-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-21
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 218-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 648-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000111
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 11 Region: 346-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000239
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030003   Gene: ENSMODG00000010878   Transcript: ENSMODT00000031572
Sequence length 724
Comment pep:novel chromosome:BROADO5:4:409628959:409637889:-1 gene:ENSMODG00000010878 transcript:ENSMODT00000031572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVTFQDVAVDFTHDEWGRLEPAQKDLYRDVMLENYQNFVSLGGLPAPKPHVISQLERG
ETPCPAEREAPRAICQDSIIWKTRLETKESASKQDISMGGSSKEKCSRIAIWDSKLPEDW
NSGVSLERQNQERLSQQVSISHRIISNESDVPECNIFGRRFKVGSILIPKQNVAIGEQQS
QSDIIGKSLLPSSDVIKHNKIALGRKLCKFKSKKPLNYHSDLFQFQRIHPGEKPLKCSHC
GKAFGSRSCLIAHQRIHTGEKPFECTECGKAYRRKAHLTQHQRIHTGEKPYKCNDCGKAF
SIDSYLIKHQRIHTGERPYKCNQCGKVFSQKGHLNQHLRIHTGEKPYECNECGKTFGQSR
HLSEHKRTHSQEKPFECNECGKLFRQLRNLSEHQRIHTGEKPYKCNECGKAFSNNYVLIQ
HERIHTGEKPYICNECGKAFSRGTYLMKHKRIHTGEIPYKCNNCRKEFTDKASFIYHQRI
HTGEKLHKCIECGKTFSQKGSLKMHKMIHTGEKPFECHECGKTFRNGGHLSVHKRIHTGE
KPFVCNECGKAFRDSGGLSAHQEKHGEKRYTCDDCGKTFRNKGYFRVHQKTHTQERHYHC
NECGKHFSLRGSFIIHQRVHTGEKPYKCNICGKAFSYNTSYSKHLRTHTGEKPYKCNQCA
KAFTQRDYLIEHERIHTGEKPFKCNECGRAFRQKQTYNAHKKIHTRKLLNIINVGKLSAR
GNTL
Download sequence
Identical sequences F6Z3K8
ENSMODP00000030003 ENSMODP00000030003 XP_007492649.1.35504 XP_007492650.1.35504 XP_007492651.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]