SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030009 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030009
Domain Number 1 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 129-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 72-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 17-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.69e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030009   Gene: ENSMODG00000008573   Transcript: ENSMODT00000031578
Sequence length 395
Comment pep:novel chromosome:BROADO5:4:409522854:409524038:-1 gene:ENSMODG00000008573 transcript:ENSMODT00000031578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYNVNQTHDYNEFGKDFMQDKHVPEHQKIHSKEKLHVCKDCGKTFSFSSSLMYHQKIHTG
EKPHKCNECGKAFILRTQLNSHQRIHTGGKPYECNECGKTFRYNSSFTYHQKIHTGEKPY
ECYECGKVFRGNTQLNSHQRIHTGEKPYECDECGKTFNQSTQLTFHKRIHTGEKPYECND
CGKAFMQSAHLISHQKIHTGEKPYECNECGKAFSSSTSLTYHRRIHTGEKPYKCNECGKA
FIQSAHLTSHQKIHTGEKPYECRDCGKVFSSNSSLIYHQRIHTGEKPYVCNDCGQAFRVN
TQLTSHQRIHTGEKPYECNECGKAFVHSTHLTFHQRIHTGEKPYECNECGKAFSSGSSLT
NHQRVHTGEKPYECNECGKSFRHNSSFLYHQRIHT
Download sequence
Identical sequences F6Z3B1
13616.ENSMODP00000030009 ENSMODP00000030009 ENSMODP00000030009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]