SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030010 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030010
Domain Number 1 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 298-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 577-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 618-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 538-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000148
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030010
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0327
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030010   Gene: ENSMODG00000027708   Transcript: ENSMODT00000031579
Sequence length 684
Comment pep:novel chromosome:BROADO5:4:409591872:409607146:1 gene:ENSMODG00000027708 transcript:ENSMODT00000031579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYQNFVSLGGLPAPKPHVISQLERGETPCLAEREAPRVISICQDSFILNTRYEIKES
SLNHGIFMEASSKERPSENHFWNSKLDEAWNFNVWLEGHKGKERLLQEVIGSHRTASELD
VHEQNAFGKRFKLGSVLVPRQRATMGVEHHQHDTLGKSFKQLSDIIDHNRNSLGKKIGNY
KCKKPVIYHSDLFQYRKLHNVEKHHTCSQCGKTFSSSSCLIAHQRIHTGEKPFKCNECTK
AYRRKAHLIQHQRIHTGEKPYVCNDCGKAFSIDSSLVKHQRIHTGEKPYKCNQCGKGFSQ
KGHLNQHQRIHTGEKPFTCNECGKAFSQYKHLNEHQRIHTGEKPYECNVCGKVFRQFGNL
SKHQRIHTGEKPYKCNQCGKAFIDNCVLIQHERIHTGEKPYICNECGKAFSRGICLKKHK
RIHTGEIPYKCNDCGKEFTDKTSFVCHQKIHTGEKLHECIDCGKTFCQKANLKKHKMIHT
GEKPFECNECGKAFRVVGQLNIHKRIHTGEKPFKCAECGKAFRDRGGLSVHKEKHGEKRY
TCSDCGKTFRNRGYFRIHRKTHNQEKRYKCTECGKDFSLRESFVVHQRIHTGEKPYKCNV
CGKAFIYNTSYSKHLRIHTGEKPYTCNECGKAFTQKHYLTEHERIHTGERPFECNECGKS
FRQKQTYKAHKKIHTRDKTLKAFS
Download sequence
Identical sequences F6YE34
ENSMODP00000030010 ENSMODP00000030010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]