SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030053 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030053
Domain Number 1 Region: 125-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 70-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 451-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 13-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 312-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000565
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 228-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000002
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030053   Gene: ENSMODG00000023480   Transcript: ENSMODT00000031623
Sequence length 510
Comment pep:novel chromosome:BROADO5:4:408942924:408944453:1 gene:ENSMODG00000023480 transcript:ENSMODT00000031623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKFYKCPQCRKAFNKSSKLILHQRIHVGENPCECNDFGKRFHHRSKLNIHQRAHTRKSP
YQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKFFSHRSKLIIHQRIHTGEKPFKCH
DCGKAFIRSSHLLQHQRIHTDEKPFKCDECGKAFNQNSNLLQHQRIHTGEKPFKCDDCGK
AFNRNSNLLQHQRIHTGEKPFQCNDCGRTFNQNSNLSVHQRIHTGEKPFQCNDCGKAFKQ
ISHLFHHQRIHTGEKPFKCNDCEKAFNRSSNLLKHQRIHTGEKPFKCDDCGKAFIRSSTL
LQHQRIHTGEKPFKCDDCGKAFIRSSTLLQHQRIHTGEKPFKCNDCGKAFNQNSHLLHHQ
RIHTGEKPFQCHDCGKAFNRNSHLLQHHRIHTGEKPFKCNDCGKAFNQNSHLLHHQRIHT
GEKTFQCHDCGKAYNRSSHLFQHQRIHTGEKPFKCDDCGKAFNWISNLLQHQRIHTGEKP
FKCSDCGKAFNQNSNLIKHQRIHTGEKPFK
Download sequence
Identical sequences F7GLW3
ENSMODP00000030053 13616.ENSMODP00000030053 ENSMODP00000030053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]