SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030054 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030054
Domain Number 1 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 101-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 45-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 158-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 257-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 358-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 465-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000599
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 11 Region: 521-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000243
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030054   Gene: ENSMODG00000016344   Transcript: ENSMODT00000031624
Sequence length 550
Comment pep:novel chromosome:BROADO5:4:408917002:409050182:-1 gene:ENSMODG00000016344 transcript:ENSMODT00000031624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIHSGKKLYKCNECEKAFNSNSSLTVHQRIHTGLKPYMCTECGKAFSQKGNLTKHKRNHT
GEKSYKCNECGKAFRDRGYLTIHQKIHTGEKSYKCNVCGKAFSQKGHLTVHQTMHTGEKS
YKCNECGKAFSQRGSFNIHQKIHTGEKSFKCDECGKGFIDRGNLNKHYKIHTGEKSYKCN
ECGKAFSQRGSLNKHHKIHTGEKSYKCNECGKAFSQRSYLTIHQKIHTGEKSYKCNECGR
AFRQKGHLTVHQRIHTGEKPYKCNECGRAFRKTGHLASSLSPHQRIHTGEQPFKCNECGK
VFRQNALLILHQRMHTGEKPYEWSGRGKAFGDSSSFTKHQSIHTGEKPNKCNNCRKPFSD
SSSFTQNQRIHTGEKPYKCTCGKSFSDSSSLSHHQRIHPGGKNPLIDTGEKPYECNECGK
AFNDGSSLTKHQRIHTGEKPYKCSDCGTSFIDSLSLAQHQRIHTGEKPYKCSECGAAFTH
TLGDSSSFTKHQSIHTGEKPNKCNDCRKSFSDSSSFTRHQRIHTGEKLYKCTCRKSFSDS
SSLSHHQRIH
Download sequence
Identical sequences F7GLW0
ENSMODP00000030054 13616.ENSMODP00000030054 ENSMODP00000030054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]