SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030081 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030081
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 609-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.37e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 177-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 658-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000264
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 276-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000068
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 12 Region: 528-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000883
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030081   Gene: ENSMODG00000023483   Transcript: ENSMODT00000031651
Sequence length 693
Comment pep:novel chromosome:BROADO5:4:405311979:405319552:-1 gene:ENSMODG00000023483 transcript:ENSMODT00000031651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSITLKDVAVDFTQEEWGLLDHSQKDLCLEVMLENIQNLLSVGLPMLREKFISCFQQGEA
PWLLDKKDPRSSCSGEILGLPVSQVHCESSLLVYVQIFLKSSTLEIIDSNIKVNKNPKSH
NVFDEKTEKFSQYSVLYQYMKLALGNCQDHEYVKHPKRKCVKIVSMSNKGGKPSSQNSEP
AAHEIIHSGEKPYECKECGKAFTWKVSLAAHQRIHTGEKPFECKQCGKAFIWKVSFTEHQ
RIHTGEKPYECKHCGKAFTKRGHLVSHQRMHTGEKPYECKQCGKAFTWKVSFTEHQRIHS
GEKPYECKHCGKAFTQRSHLATHQRIHTGEKPYECKQCGKAFTERGSLAKHQRIHTGEKP
YECKHCGKAFTNSGYLAVHQRIHTGEKPYECNHCGKAFTERGSLAVHQRIHTGEKPYECK
QCGKAFTDSGSLAKHQRSHSGDKPYECKHCGKAFTWKVSFTEHQRSHSGEKPYECKHCGK
AFTKSGHLASHQRIHTGEKPYQCKHCGKAFTDRGNHAIHQRIHTGEKPYECKQCGKAFTQ
RGSLAIHLRSHSGEKPYECKQCGKAFRDSGSLAAHQRIHSGEKPYECTQCGKAFTQRGQL
TVHQRSHSGEKPYECKQCGKAFTNRGNLAKHQRIHSGEKPFECKQCGKAFTRRSSLAQHQ
RIHGGEKPYECKQCGKAFRWRESLARHQSIHIG
Download sequence
Identical sequences F7GDH0
ENSMODP00000030081 13616.ENSMODP00000030081 ENSMODP00000030081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]