SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030092 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030092
Domain Number 1 Region: 475-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 309-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 15-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 534-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000546
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030092
Domain Number - Region: 255-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000268
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030092   Gene: ENSMODG00000023484   Transcript: ENSMODT00000031662
Sequence length 595
Comment pep:novel chromosome:BROADO5:3:521045264:521058764:1 gene:ENSMODG00000023484 transcript:ENSMODT00000031662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESGEGAGLEPWRPPEASMTFKDVAVDFTQEEWRFLDPPQKELFWEVMLENYRNLVCLG
LADANKDAISELESGEPHWIPTGSVLRTCWPDWETRSQIKESSPKMCISMEALSQQKLLG
DDPSISRMRKAWEFGDRLKKMQSMEEQPSRQVKTIQEELPNEVRDSEFSKYGLSSNPEPG
LFPQQGASVLMKCHKGDNQRESSTMYLNQGQYNQIYSRKKCPKVNQCQKMLGHSLGCIRK
HGIHSEKKVQEKEDSFPQNNELSLHQRTDTGQKCNQLTLYGKTDQAQQSPLQNTKKPYKC
SECGKALQCKESLTVHYRIHTGEKPYECRECGKAFRQQTDLIRHNRIHTGEKPYECSECG
KFFARTITLKRHQSTHTGEKPFECTECGKTFRRNSHLLSHQRRIHGGIKLHECNVCGKAF
SGKYDLTTHSSIHTGEKPYECSECGKTFRVKSNLKFHFRIHTGENPFKCSECGTAFYSKS
DLTKHNRIHTGEKPFKCDICGKAFCRNTALTQHQRIHTGEKPFKCDICGKGLPSKSSLNH
HQKTHIEEKPFLCSVCGKGFPGRKTLTAHQRTHAGKRTYECRIEERSSPGSHLTY
Download sequence
Identical sequences F7G354
ENSMODP00000030092 XP_016288482.1.35504 ENSMODP00000030092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]