SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030101 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030101
Domain Number 1 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 1-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 258-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000276
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030101   Gene: ENSMODG00000010365   Transcript: ENSMODT00000031671
Sequence length 399
Comment pep:novel chromosome:BROADO5:3:520885303:520888232:1 gene:ENSMODG00000010365 transcript:ENSMODT00000031671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFKDVAVDFTWEEWRLLDPPQKELFWEVMLENYRNLVCLVLEVRQAPNTSVLNGSNEPL
SFRTPLHSLFQSCWESRPQNKESAPKMSISMKVLSQEKFLEDDLRICKMAKAWECDGRLK
KKESMEGKPSRGIKIIQVEPPNEAGGSEYGIYSQTSSPEPGLFPQQGASSRERRYKCSEC
GKAFQKKGHLKAHYRIHTGEKPFKCSECGKAFPQKGDLKKHYRIHTGEKPFKCSECGKAF
PQKGDLKKHYRIHTGEKPFKCSECGKAFPQKGALKTHFRIHTGEKPFKCSECGRAFQQKG
DLKKHYRSHTGEKPFKCSECGKAFQQKGVLKTHFRIHTGEKPFKCSECGKAFQQKGVLKT
HFRIHTGEKPFKCSECGKAFSRAGTLKRHQSTHTGEKPY
Download sequence
Identical sequences F7F066
ENSMODP00000030101 ENSMODP00000030101 13616.ENSMODP00000030101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]