SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030116 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030116
Domain Number 1 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 18-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 620-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 395-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-18
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 667-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030116   Gene: ENSMODG00000027792   Transcript: ENSMODT00000031686
Sequence length 727
Comment pep:novel chromosome:BROADO5:3:520738553:520759492:-1 gene:ENSMODG00000027792 transcript:ENSMODT00000031686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLEECGEDAALEPCRTPQASVTFKDVAVDFTWEEWRLLDPPQKELFWEVMLENYRNLV
CLGLADSNKDVMMSKLESGEPHWIPTGGVLRSCWPGWESRLQTKESAPKMSISVKVLSQE
KFLEDDLRICKMAKTWECDGRLKKKESMEGKPSRRIKIIQAEPPNEAGGSAYDKYSQTPS
PEPDLFPQQGASVVMQGQKGDNQRGSSTMYLNQGQRDQIHSRKKRRKVNKCQKVLGHDLG
SIKKRGILSEETVHETGNSFPRINECGPHQTTDRRKKCNELTKWRKTVCAELYSRCQSRE
RRYKCSECGKAFQQKGDLKTHYRIHTGEKPFKCSDCGRAFQQKGDLKIHYRIHTGEKPFK
CSECGKAFSRAGTLKRHQSTHTGEKPFGCSECGKTFRRNSHLLSHQRRIHGEIKLHECNV
CGKAFSRKYDLTTHSSIHTGEKPFECSECGRAFQQKGDLKIHYRIHTGEKPFKCSECGKA
FSRARTLKRHQSTHTGEKPFKCSECGKAFLHKGALKRHYRIHTGEKPFKCSECGKAFQQK
GALKRHYRIHTGEKPFKCSECGKAFQQKGTLKIHYRIHTGEKPFKCSECGKAFSRARTLK
RHQSTHTGEKPFDCSECGKAFQQKGALKIHYRIHTGEKPFECSECGKAFPRNSHLLSHQR
TIHGEIKRHECNVCGKAFYRKYDLTTHSSIHTGEKPFECSECGKAFPRNSRLLSHQRRIH
GGINLHE
Download sequence
Identical sequences F7EZW6
ENSMODP00000030116 ENSMODP00000030116 XP_016288041.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]