SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030184 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030184
Domain Number 1 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 333-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 6 Region: 113-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-17
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 254-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000151
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030184   Gene: ENSMODG00000023509   Transcript: ENSMODT00000031755
Sequence length 391
Comment pep:novel chromosome:BROADO5:4:404856843:404865037:1 gene:ENSMODG00000023509 transcript:ENSMODT00000031755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQEAVTFRDVSLDFTWEEWECLSAVQRELYRDVMLENYRNLVSLAGLPDPKPGLISWLE
GREEPQMWDPLGHAARNPSLGEREGPQMILDKKTPAEHRGHEWVDTGKKIHKKTYRCKTC
GESFTQYSYLVNHERMHNGERLYECKECGKAFNWKSYLIGHQRIHTGEKPYECKGCGKAF
SHSSALIAHQRVHTEEKPYRCKECGKAFKWKSGLNQHQRIHTGEKPYQCKDCGKAFNWKT
PLIQHQRIHTGEKPYKCGECGKAFSQNSALIVHTNIHTGEKPYQCKECGKAFHLNSHLIQ
HQRIHTGEKPYECKECGKAFNQSSSLIIHQRMHTGEKPYECKECGKAFSRSSSLFEHRRV
HTGERPFKCKKCGKSFNRNSYLIQHQNSHWT
Download sequence
Identical sequences F7DER2
ENSMODP00000030184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]