SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030190 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030190
Domain Number 1 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 7 Region: 158-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-19
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 8 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 121-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000796
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030190   Gene: ENSMODG00000023512   Transcript: ENSMODT00000031761
Sequence length 539
Comment pep:novel chromosome:BROADO5:4:404678744:404686290:1 gene:ENSMODG00000023512 transcript:ENSMODT00000031761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLVTFQDVTVDFTQEEWSLLDQSQKELYMEVMLENAQNSLFLGLLVPRHSLISCFQQGES
QWIRESKGPRNSCPGERKIKFNVKEMGTKLSIFAEEFHQERSIGHASYSLKYPEIYTSDD
PYKHNECGIAFSYMSHFIDHQRTNNGEKLYECNKGGKAFRSSSNLKYQEKMHIGKNLHEC
NQCGKAFTGRTTLKYHEKIHTGEKPYECKQCGKAFTDRGYLATHQRIHTGEKPYKCKQCG
KAFTWRDCLVKHQRTHTGEKPYECKQCGKAFTDSGYLATHQRIHTGEKPYECKQCGKAFT
DRGYLATHQRIHTGEKPYECKQCGKAFTDRGYLATHQRIHTGEKPYKCKQCGKAFTWRDC
LVKHQRTHTGEKPYECKQCGKAFTDRSSLAKHQRIHTGKKSYECKLCGKAFSVRDSLAQH
QRIHTGEKPYQCKQCGKAFTDRSSLATHQRIHTGEKPYECKQCGKTFTVRRYLSAHQRIH
AVEKPYECKQCGKAFAERGHLARHRRIHIEEKPYECKDCGKAFTQRSSLSIHQRFHTGE
Download sequence
Identical sequences F7DE78
ENSMODP00000030190 13616.ENSMODP00000030190 ENSMODP00000030190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]