SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030218 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030218
Domain Number 1 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 703-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 165-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 123-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 12 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-20
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 13 Region: 437-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-17
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030218   Gene: ENSMODG00000023517   Transcript: ENSMODT00000031789
Sequence length 782
Comment pep:novel chromosome:BROADO5:4:404472799:404492242:-1 gene:ENSMODG00000023517 transcript:ENSMODT00000031789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTFQDVAVDFTQEEWRLLEPPQKELYREVMLDNARNLLSLGLPVPREDLISYLEQREAP
WMLGQEGLRSCCAGEIFLLYMREFTLDRNVMNVESLLDTGPVLFNIRESTLERNLINVIN
RIHTGEKPYQCNQCGKAFRKRCHLALHERIHTGEKPYQCNQCGKAFTQKEVLAVHQRIHT
GEKPYECKQCGKAFRSSSILSRHQRIHTGEKLYECHQCGKAFTNSSSLTYHQRIHTGEKP
YECHQCGKAFTRRGHLAAHQSVHTGEKPYECKQCGKAFIYRYRLIHHERIHTGEKPYECF
QCGKTFRSTPDLSIHKRIHSGEKPYKCFQCEKTFRSSSSLAGHQRIHTGEKPYECLQCGK
AFGSSSSLRKHQRIHTGEKPYKCNQCGKTFTESFSLTYHQRIHTGEKPYECTECGKAFRS
SSSLRHHERIHTGEKPHDGKTSYECNQCGKTFRKRCHLALHERIHTGEKPYICHQCGKSF
RISSSLAIHHRIHTGEKPYECQQCGKSFRISSSLAVHHRIHTGEKPYECHQCGKTFRSTP
NLAVHKRIHTGEKPYECFQCGKTFRRSSGLANHQKIHTGEKSHKCNQCGKAFTQKSAHTY
HQRIHTGEKPYECNECGKTFRRSFSLAKHQRIHTGEKPYECSQCGKTFRSSSNLWYHQRI
HTGEKPYKCNQCGKAFTESSSLTYHQRIHTGEKPYECTECGKAFRSNSKLGQHQRIHTGE
KPYKCNQCGKAFRSNSSLRYHERVHTGEKPYECLECGKGFNRHSSLTKHQRIHTEEKSYV
HN
Download sequence
Identical sequences F6Z2N9
ENSMODP00000030218 ENSMODP00000030218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]