SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030224 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030224
Domain Number 1 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 563-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 134-194
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 608-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 246-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000368
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030224   Gene: ENSMODG00000029425   Transcript: ENSMODT00000031795
Sequence length 668
Comment pep:novel chromosome:BROADO5:4:404360529:404382640:-1 gene:ENSMODG00000029425 transcript:ENSMODT00000031795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGFQFSNRGGKKVTNQELGREPIAPPLPSPPRPAKDLAERVPDRKRTTFPGGRRGLFLL
SAGSAPSERASGPGSACAAAVLPWTSRGLLCWGWSLSPGGWARKRKETPVGGQGSSQARG
REPEGMAPGSPRPSPQELVTFHDVAVDFTPEQWGLLDHPQKLLYKEVMLENAQNLLSLGL
PVPREYLLSCFEQEGLKNSCQDAETRFGVKKISEKLKLSSQISYSQYNEYKDDFTKHERI
YAEVENYEFSQHGKAFRKSSRVTQNKKIHPEEKPVECHECGKAFKNHSYLIIHERMHSGE
KPYECNQCGKAFIVRGHLARHQRIHSGEKPYECNQCGKTFRDSYGLTRHQHIHSGEKIYE
CTQCGKAFKDNYSLTKHQSIHSGEKPYECNQCGKTFRYNYSLTKHQSIHSGEKLYECNQC
SKTFFRKSSLTRHQHIHSGEKRYECNQCGKTFRDNFCLSTHQLIHSGEKPYGCNQCGKTF
RFSCSLTTHQRIHSRERPYKCNQCGKTFRCGSNLTIHQRIHTGEKPYKCNQCGKAFARKH
RLTCHYTIHNEKKPHECHECGKTFAVRSSLIVHQRIHTGEKYECTECGKAFTNSSSLTYH
QRTHTGEKPYECNQCGKAFRINSNLAVHKRTHTGEKPYECHQCGKAFSWRNSFVYHQRTH
CGKKPECH
Download sequence
Identical sequences F6Z2J3
ENSMODP00000030224 ENSMODP00000030224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]