SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030227 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030227
Domain Number 1 Region: 16-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-27
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 611-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 667-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 293-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 709-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 11 Region: 227-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000181
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030227   Gene: ENSMODG00000004552   Transcript: ENSMODT00000031798
Sequence length 768
Comment pep:novel chromosome:BROADO5:4:404320525:404335485:-1 gene:ENSMODG00000004552 transcript:ENSMODT00000031798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMEERTAGFRAAGSRAPVTFKDVAVDFTQDEWGQLDPSQRSLYRDVMLENYENLVSLG
LPVSKPDVISQLERGRGPWRLAGDFPRALRADSFIQETRSETMSSTPKRCIYIKVPVHGR
LQRNELKVEKALEYEATLEREKSHQRKQSRQVTIAAKSLAKQRHFHESNSRGRTCNVGSI
FVPKPNIPIGKSHQDDGSQENSIKPISAPVKHSKVSKGKSLSKQSDHSDFAQLHITHSGD
KPCTCSECEKAFSKSAHLVENQKTYPGKKSECEREFSQSGSPSPNESFNIFDKPFKCHYC
GKAFNNNSSLILHLRIHTGEKPFKCNECGKAFSQRGNLNEHKKIHTGEKPFKCNECGKAF
SSNSSLTLHQRVHTGEKPFKCNECGKAFSQRGNLNEHKRTHTGEKPFECGECGKAFSQRG
HLTEHQRIHSGEKHFECSECGKAFNHRVSLIDHQRIHTGEKPFECNECGKAFNQRGHLNE
HKRIHTGEKPFECNECGKAFIHKGSLTEHQRIHAGEKPLECNECGKTFSHRTSLYSHLRI
HTGEKPFECNDCGKAFSHNASLIYHQRIHTGEKPFECNECGKTFSHRRSLLHHQRVHTGE
KPFQCNDCGKAFSQRGNLFYHQRIHTGEKPFECSECGKAFSHSTSLIYHHRVHTGEKPFE
CNECGKAFSQRGQLNKHQRIHTGEKPCKCNECGKTFSQTGHLLRHQRVHTGEKPFACNKC
GKSFSQRGSLVLHQRIHTREKPFQCSVCSKAFSHRTSLICHQRNHNGK
Download sequence
Identical sequences F6Z2G9
ENSMODP00000030227 XP_007492496.1.35504 ENSMODP00000030227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]