SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030355 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000030355
Domain Number - Region: 1151-1188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000446
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number - Region: 1080-1122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0337
Family HkH motif-containing C2H2 finger 0.08
Further Details:      
 
Domain Number - Region: 760-879
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.034
Family beta-sandwich domain of Sec23/24 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030355   Gene: ENSMODG00000018974   Transcript: ENSMODT00000031927
Sequence length 2241
Comment pep:known_by_projection chromosome:BROADO5:2:287590347:287613212:-1 gene:ENSMODG00000018974 transcript:ENSMODT00000031927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSSGRSSVSSHRPKESGGVGVGGGGSRNSRSAGSSSSSTGPVRRASPPPVSSSSSASS
RPPCRRPRSPSGHRGRHSPSPPPHSVRGRRRGSPSPPWSRRGSPSPPRGRRGSPSPPRSR
RASPSPTRPRRLFPSGSGGFRGSSRSCSRSDFARDGRGDHPGDSGSRRRSPGLRSESSVE
QSLRITVGNDRFCLGSPDPRRLNDRLGSPVDNLGDIDRDDLADGPIFTHSSQCSRGLERY
TTREEGPLSPFLGRLDEDYRTREAFLHRSDYNPHVSRHDDLLRDRDKLKVSYSVRSEERS
REAKRSRYDDSEKIHSLGGDHPNYASGARNYRQRRHSPSSRFMDPEFRELDLARRKREEE
EERNRSMGQDLVGVDSSSSSSCTISGVSGSEPGYTVHRPEDVPMMPKKSILKKRVEVVVE
PSLQMESFSSSTNSSQELPLISGHPSLPPSSATVPFASEVENNKGALTETALKEPQESYQ
WGPLSGLPKDTSPLREKFGSFLSHKEKIDGKVESGERHTDFLLPHERASQDGSGFSRILG
MLAEPTSAQEKRRRSFPDIEDEEKFLYGNEEEDLKPEFPPKSLGGLGSEARRERANSSPS
PSSALKLEGRDETNPEYAKIHNLLKTIGLDIGVAEISKLAVRTQERLHGKKFPSHSSLDR
RSVDRRSLSDRSSSDSHRLESREARRSDTRSPEMSRPHMASPVDPYLRAKNSPPFLKSDH
SMSQIPGPEVANSGPRASAIRCLIPSAPAPPIRLPHCTSSVTQFQIPTNTQFSAAQIPPD
YQTPPIPPSTYDAYRHYMAYAVSAWPMYPSPQQPSHPLTDPHRLIPVTKQVTPSRPNLRV
IPTIPPAESKREESMLVPIPVINNSNKVPVRLPIPPLMRYNPEKISDEKNRASQKQKVIE
EREKLRSDRDARQKKMYYLRTELDRLHKQQGEMLRKKRREKDGHKDPLLVEVSRLQDNIM
KDMAELRREAEAAEKKQSELDKVAQILGINIFDKTQKPSNDSKESSEKSGKAEKSKSPEK
VSPSSNNSSSSSSSSSSSSSKESKSNNEKSHAKSPKPTDTSSQPLAKQSSQLATVYEYYD
AGNHWCRDCNTICGTMFDFFTHMHKKKHRQTLDPYNRPWASKIQSEAKQDNTKRADKITV
PAKGSEFLIPITGYYCQLCEEFFGDPISGEQHVKCHQHNEKYKKYVDENPLYEERRNLDR
QAGLAVVLETERRRQNELKRKLSEKPKEETDEKKAKVVKETKEDEEKLSEELDEQLSETW
NSPDKLENKRKMIIKLQLKEETKEPQTSSSFGKFSWKKSEKDDEKTSGVAPSIPKEESIE
TNKDKEDGKAQAGKVKPIEIKLSGKTVIAHTSPWMPVVATSTQAKIRPNLPIPTTVLRKS
GSATVSKPAPLNTFLSIKSSGATTKPLPVVKESSTDLLLPPDIISKAFGGEEVILKSSPE
EKTVVAEKNEPAPIPEQLLPPPPPPPPPPPLPVTPKSASTPPAQTTTVLSPVKSTPTLSQ
ILTPGIGGSNLLTPVLPSSILAPVHPTAIPSDEVAPGVSESDHDQALLSVLVRPPPPLSG
VFSEQAKKLEKRNSCLATANAKDLYDIFYSSGGKGNPESKLGNSTLSNGESSNYSKNENS
DSSSSPKESGIFLRGMSQDKGLTSVPLDSCLAKSNAKTMESPKQQTIVEQNLGLKSRGCL
QPLTGTDFGTTSLADDQVKPQEEVNPEASASTMFSSSSYESETNRDIRLEGEADLNSGEP
GPPGVEEPAPQMSDILCPANLVDTKDLGIVDSQAKRISDPYLAEEHCADEAEAATELEDG
RLLLSEGVGKERIGDQVEELQTLSSIVPKDSKEDSHAWKKEAKQTKLLGEVMTEPCIQAL
SALEIKTDSKQTPDTRFISQTPQSIGVQHCAEESSFQSILKRNIYLTSCPQVQAVLASFE
DCQEDQSPEPTGRTPKIRGFKPMGKKPKEKLKKMVYQSAVLEKETKKPENIEIPKGQESG
SSDLSITCTEPILATESKPIGLETTDLKKPRASGKPSVFSSDPSKPVQGFLSGQSKNIHV
GRFSCSTLSEFRFVLPETTELDLEMKDKQNSKPGNEKMLTSDTLKTQPELKVDTDMEVAH
EPLDLQAEGMLSVDTEKTFKLEAEGSLGLESDTVCSPGLRPSACQPDLVSIVTSVSEKQE
EKLCSLPSEPSDLPESSSLDTSTEFQSPHSVIETFSQMDKDSTLSATEMPALSYPGKEWV
ISAAIGPKEMSTQEEGTVDAT
Download sequence
Identical sequences F7CTC9
XP_007484022.1.35504 ENSMODP00000030355 ENSMODP00000030355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]