SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030392 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030392
Domain Number 1 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 47-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 8 Region: 671-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 303-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030392   Gene: ENSMODG00000012515   Transcript: ENSMODT00000031964
Sequence length 726
Comment pep:novel chromosome:BROADO5:4:401000491:401125827:-1 gene:ENSMODG00000012515 transcript:ENSMODT00000031964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECQKDSRRVGEVTGRKLEAGAEPSKAPALAQDRSLEKGSALELLTAGYQRPLTFGDVAV
DLSLEEWRRLSPAQRGLYREVMLENYEHLVCVGLSGSKPSVISRLEQAAPWVPEGECPGG
PPPDSFHQETGYENKDSVLTEGTCLDALAKERVPQDNPWYLNRGEFGESEVKFESQKGPQ
EGESQQLIVTHKRTFCETNVLDCNSFERHFSLGPVFFPQWRAVIGKSLHKYTTLEKNFRQ
FSDRIQHNAVASGKKLNMHDPDKKTLGCHSDLIKCHRACAGEKPDPGKTFEKRTNFTQQQ
GLHTREKLFECNDCGKGFRRKHYLKSHQRTHTGVKPFECNQCGKAFNDSRNLIRHQKIHT
GVKPFECNECGKAFNERQSLIRHERTHSGVKPFKCNECEKAFGWRENLISHQGTHTGIKP
FECNECGKGFRRKHYLKSHQRTHIGVKPFECNQCGKAFNDSRNLIRHQKIHTGVKPFECN
VCGKAFNERQTLIRHERTHTGVKPFECNECEKAFMRKDCLKSHQRTHTGVKPFECSECGK
AFSQKGHFIIHQRTHTGVKPFKCNECGKAFNDRQSLIRHQRTHTGVKPFKCNECGKAFND
RQNLIRHLRTHTGVKPFECNECGRAFNDRQNLIRHQRIHTGGKPFECNECGKAFSASQNL
IRHQKIHAVGKPFECNECGKAFSQKGHLLSHQTIHTGTRAFECNECGKAFSQRGSLNRHQ
RTHTRM
Download sequence
Identical sequences F7C8P8
ENSMODP00000030392 ENSMODP00000030392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]