SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030395 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030395
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 1.73e-22
Family BTB/POZ domain 0.0027
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000976
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 310-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000797
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030395   Gene: ENSMODG00000023551   Transcript: ENSMODT00000031967
Sequence length 426
Comment pep:known_by_projection chromosome:BROADO5:1:416806371:416807651:-1 gene:ENSMODG00000023551 transcript:ENSMODT00000031967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESDVLHFQFEQQGDAVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVIFAACSTFMRD
QFLLNQSKQVRITILQSAEIGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCT
EALSKYLEIDSSMKNNSQSAEICHSSYPELKDEDENLDRDCEIIEISEDSPVNLDIEVKQ
EKDNALQPTIQGLLLDKKDMKTSEISAVEIGYKDDEICIFRMDSINVPTVESEQFSQPCT
SSKTNIYFPETQHSLINSTVESRMTEVPGNHFQGFIGESAEGNIGITNGLQSLEEGYSWR
HQCPKCPRGFLHLENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCSVCL
KTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGERANLDVITK
VKIDYD
Download sequence
Identical sequences F7BQW3
ENSMODP00000030395 ENSMODP00000030395 XP_001371223.1.35504 XP_007474679.1.35504 XP_007474680.1.35504 XP_016286207.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]