SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030443 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030443
Domain Number 1 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-27
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.68e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-22
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 7 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000663
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030443   Gene: ENSMODG00000023562   Transcript: ENSMODT00000032015
Sequence length 715
Comment pep:novel chromosome:BROADO5:4:401855662:401873675:1 gene:ENSMODG00000023562 transcript:ENSMODT00000032015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYRTPRPPSQGLITFKDVAMNFTQEEWCLLDHSQKELYTEVMLENVQNLHSVGLPVPRE
DFISCFQQREAPWLLEKKVPRNSCPEAETNFEVRKISTKLSHFVEGSGLQRCMNKSLCSF
ILREIFDSNIKGNRNPKSDCEFDETAKKFSQYSVLNQYTKLTSGNDCCLVSKYSNGFLEE
IGLVQSPEKTPKIFMYLGNPGGMAFGSSSDLIRHPKSKHVEMVFVNNKDGKPFSQNSKLG
SHQIIHGREKPYECKHSGRAFTLSSDLAAHQRIHIGERPYECKQCGKTFTERGNLVAHQR
IHTGEKPYECKHFGKAFTWNDHLASHKKIHIGEKPYKCKQCGKAFTIRSHLATHQRIHNR
AKLYKCKQCGKAFTQRRSLTEHQRIQTGEKPYECKQCAKAFTRRSELVAHQRIHTGEKPY
KCKHCGKAFTQSSGLVTHQRIHTGEKPYECKHCEKAFTRSDYLTEHERIHTGEKPYECKQ
CGKAFTQSGHLASHQRIHTGKKPYDSKQCGKTLIERSSLATHQRIHTREKPYECKQCGKA
FTQKSSLVAHQRIHTGEKPYECKYCGKSFTQRSGLVAHQRIHTAEKPYKCKQCGKTFTQK
SSLAAHQRIHTGEKPYKCKQCGKTFTQKSSLAAHQRIHTGEKPYECKHCGKAFTRSGYLT
SHQRIHTGEKPYECKHCGKAFTQRSQLVVHQRIHTGERNLMNVHSVEGLSQSLSV
Download sequence
Identical sequences F7GKL2
ENSMODP00000030443 ENSMODP00000030443 XP_016277856.1.35504 XP_016277857.1.35504 XP_016277858.1.35504 XP_016277859.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]