SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030455 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030455
Domain Number 1 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 671-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.46e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 727-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 615-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.63e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 152-213
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-22
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 9 Region: 771-829
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 11-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 333-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000625
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 59-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000346
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 13 Region: 466-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000658
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030455   Gene: ENSMODG00000023570   Transcript: ENSMODT00000032027
Sequence length 830
Comment pep:novel chromosome:BROADO5:4:402050501:402072470:1 gene:ENSMODG00000023570 transcript:ENSMODT00000032027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLSNKGGKTFPQNSKLAGHQRIHTGEKPYECNLCGKTFTKSSSLTKHKGIHNKKGLHE
FKQCGKVLKEKDNLAEHQRIHTEEKHFEYKHCGKAFTHVSNLIECKKIYTGEHGMQRESL
STLSILPEEHQNLAQGETLEPERMIPETQRPPTQESVTFQDVTVDFTQEEWCILDRSQKK
LYREVMLENVQNLLSVGLPVPREDLISSCQQGESPWLLEQKGTRSFCPDAETSFEVKEMS
TKLSLVVKGSEKFRQYSILNQYKKMTSGNDYQNNDYNKYFPEKAELLQSHGKPPERPIYQ
DNLEEMAFTWRSSVIRYPKSNSGKKLSVSSKDNKGFRQNSERARDQRIHTREKLYECKEC
GKAFTQRSSLVEHQRIHTGEKPYECKQCGKAFTVRGHLIVHQRIHTGEKPFKCKQCGKAF
RQKGKLAVHQRIHTGEKPYDCKECGKAFTTSYSLALHHRIHTGEKPFKCKQCGKAFTQGG
SLAEHQRIHTGEKPYDCKECEKAFTTSYSLAVHQRIHTGEKPYECKQCGKAFKASAHLAR
HQRIHTGEKPFKCKQCGKTFTRSSNLIEHHRIHTGEKPYECKQCGKTFTVRGHLAIHHRI
HTGEKPFKCKQCGKAFTQRGSLAEHQRIHTGEKPYDCKECEKAFATSYSLAAHHRIHTGE
KPYECKQCGKTFTQSSTLAAHQKIHTGEKPYECKQCGKAFTQSSGLAAHQKVHTGEKPYE
CKQCGKTFTRSFSLTEHHRIHTGEKPFKCKQCGKAFTTNSNLTEHYRIHSGEKPFKCKEC
GKAFTENRILAAHQRTHTGEKPYKCKQCKKAFTWRSSLSTHQRIHTGEKL
Download sequence
Identical sequences F7GC89
ENSMODP00000030455 ENSMODP00000030455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]