SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030468 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030468
Domain Number 1 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.53e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 51-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-18
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 5 Region: 12-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000223
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 107-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000891
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 248-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000186
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030468   Gene: ENSMODG00000023566   Transcript: ENSMODT00000032040
Sequence length 454
Comment pep:known_by_projection chromosome:BROADO5:2:250044811:250046439:-1 gene:ENSMODG00000023566 transcript:ENSMODT00000032040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYPFPAMYGAGKPYKCIECNKSFRYSSVLHLHQRTHAGDCCYRCLECGEGFAQNSELRAH
QRTHAGETLYICNECGKSFHQSAYLDLHQSTHTRGRPCKCHVCGKHFRYRSVLYCHQRHH
PREMPYQCPVCGKSFRQSAYVFHYERTHSGSSALATAEKPYQCGECHRDFRSSSGLLKHR
RAHQCSHGMTRIHPCNVCGKSFSKSSTLTRHQQTHTGEKPFKCPECGKCFTESATLVRHH
RIHTGEKPYACPDCGRKFSESSTLMRHRRSHKGEKPHQCTTCGKSFGQRSDLIVHQRIHT
GEKPFPCPECGRRFSDRSDLTKHKRTHTGEKPYRCEECGKFFTCVSNLNVHKRNHAGDKP
HKCPECGKCFSVGSKLTLHRKTHQGERPSECAECGKCFSHSRSLSQHQRAHARARAAAGV
TTGGLVGVAPTLIFSVDPGQEKSGLMVTGVGERY
Download sequence
Identical sequences F7GBY1
13616.ENSMODP00000030468 ENSMODP00000030468 ENSMODP00000030468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]