SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030484 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030484
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily POZ domain 7.06e-30
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 398-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-16
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 367-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000176
Family Classic zinc finger, C2H2 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030484   Gene: ENSMODG00000019790   Transcript: ENSMODT00000025137
Sequence length 471
Comment pep:known_by_projection chromosome:BROADO5:1:422367952:422369367:1 gene:ENSMODG00000019790 transcript:ENSMODT00000025137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICNEMESGTSSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHLFRAHKAVLAASSP
YFCDQVLLKNSRRIVLPDVMNPRVFENILLSTYTGRLVMPALEIVSYLTAASFLQMWHVV
DKCTEVLEGNPTVLCQKLNHSSDHQSPSSSSYNGLVENFELGSSGHPDFPKTQELRDGEN
EEESSKDELSSQLTEHEYLPSNSSTEHDRLSTEMTSQDGEEGASDSAEYHYTRPMYSKPS
IMSHKRWIHVKPERFEQDCEGVDVHAAYDEHQVTESINTIQTDHAIQSSGVDEDFHIGEK
KVEAEFDEQADESNYDEQVDFYGSSMEEFSGERADGNLSSHRQDTIIAAGYSDSIEMVTG
IKEEASHLGFSAADKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLV
GHMKIHTGIKPYECNICGKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTDVN
Download sequence
Identical sequences F7G1H9
ENSMODP00000030484 13616.ENSMODP00000030484 ENSMODP00000030484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]