SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030507 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030507
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 38-100
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-24
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 6 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.08e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030507
Domain Number - Region: 198-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000573
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030507   Gene: ENSMODG00000008527   Transcript: ENSMODT00000032078
Sequence length 560
Comment pep:novel chromosome:BROADO5:1:423581707:423600457:-1 gene:ENSMODG00000008527 transcript:ENSMODT00000032078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLTHMLGERALLSQDSTFPQEGSMEEERINSGLLTAKSQESLTFKDVAVDFTPEEWGQ
LYPAQRDLYREVMLENYRNLVSLAGHQVSKPHLISQLEQRKEPWMMERKIPRGNSPVWAL
YFKQLVILSPVDKFFPGKYRHKESHPSNQPDGLWCSTFREALECNGQLGRQQRIKERMLK
QMTVTHEKNFSSKNHSDCNELGISLSLRSIPDPKKRSSLGRRGNKCDTCGKTFKHNLELI
KHQQICAGKKPYECDDCGKTFSQISYLTQHRRIHTGEKPYECSECEKAFSQISYLTQHRR
IHTGEKPYECNECGKTFSQRTHLTWHQRIHTGEKPYKCNECGKAFSITSSLNKHWRIHTG
EKPYECIECGKAFSRSTALTQHQRIHTGEKPCHCNECGKAFSRRTALTQHQRVHSGEKPY
HCNECGKAFRQHRALTQHQRIHTGEKPYQCSECGKAFSNRSSLIQHQRIHSGEKPYECNE
CGKAFSWRTHLTQHLRIHTGEKPYQCNECGKAFSDRSSLTQHQRIHTGEKPYQCNECGRA
FSRNSSLTKHQRVHVGEDPF
Download sequence
Identical sequences F7DBW2
ENSMODP00000030507 ENSMODP00000030507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]