SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030511 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030511
Domain Number 1 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-21
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 8 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 230-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000015
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 10 Region: 363-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000039
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 11 Region: 448-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000103
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030511   Gene: ENSMODG00000027758   Transcript: ENSMODT00000032082
Sequence length 703
Comment pep:novel chromosome:BROADO5:4:402432371:402468317:-1 gene:ENSMODG00000027758 transcript:ENSMODT00000032082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRTPRPPSQGFITFKDVTVDFTQEEWCLLDYSQKDLYREVMLENVKNLFSVGLSVLRE
DFVSSFQKGEGTWLLEQKGSKSSCPGTQTNFEVKEVSTKLSLFVEGHGLQRCTNEGLSDF
ILRKVCYSNIKGNENSKSDSEIDGTAAKFSQYSVLSQYTKLTSENDCSQDSLYSKCFPTE
LDPIQLAEKPLEMPLYQGHLEEMAFGSSLDLNRYPKTKHAEMVSVSNKDGRSFSQNSECG
SHQIIHSEEKPYKCKHCGKSFTRRDSLASHQKVHTGEKPYKCKHCGKAFTQKSNLSVHER
IHSEEKPYECKHCGKAFKQRSVLVSHQTIHTGEKPYECKHCGKAFTRSDSLAAHQRIHTG
EKPYECKQCGKAFTQRGHLAIHQRIHTGEKAYECKHCEKAFTLRGHLVRHQRTHTGEKPH
ECKQCGKTFADRASLSAHQRIHTGEKLYECKQCGKDFIRRGRFAAHQRIHIGEKPYECKQ
CGKAFTLKEHLATHQRIHTVEKPYECQQCGKTFTLRGYLVRHQRIHSEEKPYECKHCGKA
FKQSSVLVGHQRIHTGEKPYECKQCGKAFIWKMDLVLHQSIHTGEKPYECKQCGKAFTRR
DKLAAHQRIHTGEKPFECKQCGKAFTVRGTLVSHQRIHTGEKPYECKQCGKTFTWKMSLI
PHQRIHTGEKHYECKQCGKSFTHRHSLTAHHSIHSALKPHKCK
Download sequence
Identical sequences F7DBN0
ENSMODP00000030511 XP_007492384.1.35504 XP_016277875.1.35504 XP_016277876.1.35504 XP_016277877.1.35504 ENSMODP00000030511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]