SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030512 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030512
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 7 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030512
Domain Number - Region: 205-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000149
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030512   Gene: ENSMODG00000029397   Transcript: ENSMODT00000032083
Sequence length 701
Comment pep:novel chromosome:BROADO5:4:402369627:402615750:-1 gene:ENSMODG00000029397 transcript:ENSMODT00000032083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGTPRPPSQGSITFKEVAVDFNQEEWCLLDHSQKELYLEVMLDNVQNLLSVGLPVSRE
DFISSFQRREGTWLLEQKRLKSSYPGAQTNFEVKEVSTKLSLFVERYGLQRCTNECLSDF
ILREVCYSNIKGNENSKSDYEIDGRAEKFSQYSVLSQYTKLTAENDYSQNSEYSKCFPTE
QDVIHLAEKPLEMPLYQDHLEGMSFGSSLDLSRYQKTKHVEMVSMSNKDGRSFSQNSELD
SYQIIQCVEKSYECKQCGKFFTRRDSLASHQTIHTGEKSYKCKHCGKAFTQKSNLAVHER
IHSEEKPYECKHCGKAFKQRSVLVSHQRIHTGEKPYECKQCGKTFTRRDSLTAHQRIHTG
EKPYECKQCGKAFTQRGHLAIHQRIHTGEKAYECKHCEKAFTLRDHLVRHQRTHTGEKPF
ECKQCGKTFADRASLGAHQRIHTGEKLYECKQCGKNFIRRGRFVAHQRIHIGEKPYECKQ
CGKAFTLRDHLATHQRIHTGEKPYECQQCGKTFSLRGYLVRHQRIHTEEKPYECKHCGKA
FKQSSVLVGHQRIHTGEKPYECKQCGKAFIWKMDLVLHQRIHTGEKPYECKQCGKAFTRR
DKLAAHQRIHTGEKPFECKQCGKAFTVRGNLVSHQRVHTGEKPYECKQCGKTFTWKMSLV
PHQRIHSGEKPYECKQCGKVFTHRSSLTAHHSIHTALRPHE
Download sequence
Identical sequences F7DBL9
ENSMODP00000030512 ENSMODP00000030512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]