SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030521 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030521
Domain Number 1 Region: 834-891
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 977-1034
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 1033-1088
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 779-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 443-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 11 Region: 722-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 331-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 13 Region: 880-932
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 14 Region: 939-991
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 15 Region: 9-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 16 Region: 221-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000013
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 17 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000077
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 18 Region: 181-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000749
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030521   Gene: ENSMODG00000023579   Transcript: ENSMODT00000032092
Sequence length 1089
Comment pep:novel chromosome:BROADO5:4:402695647:402770085:1 gene:ENSMODG00000023579 transcript:ENSMODT00000032092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSPGPPAQVLVTFKDVAVDFTQEEWRLLDPHQKELYKEVTLENAWNMLSMGLPVPRD
LVSHFKQVEAPWMLEEEGSSNSCLDGERRLEVRQTTAKFREESQQQRVMNDGHCDFSLRK
ICVSDFKIGKKQHEFDKNGKSIMQYSILIQCKKVISGNDYSQDSKYRECFSVHKKPPVLQ
TYQCHDCEMTFNLKSELIGHQKSHAGEMLYIHNATEKAISHNSELTDHQKIHNGKKYYEC
NNCGKAFKKQLSLHHHQKLHTSPKQHKCMQCGQAFSRQSSLISHQKIHTRETSSKYLECI
KTLSEDSSPIVYQRSHTGEKPYECNQYGKKFNQKSTLAQHQGIHTGEKLYECNECGKSFR
QKSSLAAHQGIHNGQKPYECKQCDKTFTQRGHLSVHQRIHTGHKPYECKQCDKTFTQNSS
LTEHQRIHTGEKPYKCHQCGKNFRLSSSLNAHRKIHTGEKPHECNQCGKTFKCNSDLIKH
QRIHTGEKPYECKQCGKTFTQSSTLALHQRIHTGEKPYECKQCGKTFTQSSTLALHQRIH
TGEKPYECKQCGKAFTQSSTLALHQRIHTGEKPYECEDCGKTFSNCSSLVVHKRIHTGEK
PYECNQCGKTFTQSSKLAQHQRIHSGEKPYECNQCGKAFRRSSHLAGHKRIHSGEKPYEC
DDCGKTFKDCSSLVVHQTIHTREKPYQCNECGKSFRQKSSLVAHQGIHTGEKPYECNQCE
KTFRCRSSLAQHKRIHSAEKPYECNLCGKSFRCNSKLALHQRIHTGEKPYECNQCGKNFR
QSSSLAEHRRIHTGEKPYECKQCGKTFTQSSSLALHQRIHIGGKPYDCKQCGKTFTNTSN
LAEHQRIHTGEKPYECNQCGKSFRQSSSLTEHQRIHTGEKPYKCNQCGKCFRQSSSFTEH
QRIHTGEKPYKCNQCGKTFRHSSSLANHQRIHTGEKPYKPYECNQCGKTFRCNSGLALHQ
RIHTGEKPYECNQCGKTFRCNSGLAKHQRIHTGEKPYECKQCGKSFRQSSNLAEHKRIHT
GEKPYECNQCGKAFRFNSKLVLHQRIHTGEKPYECDDCGKTFRDRSSLVVHQTIHTGEKP
YECNQCGKT
Download sequence
Identical sequences F7CSM2
ENSMODP00000030521 ENSMODP00000030521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]