SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030555 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030555
Domain Number 1 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 131-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 187-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 47-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 248-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-25
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 5-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 458-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000583
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 94-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000265
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030555   Gene: ENSMODG00000011769   Transcript: ENSMODT00000032126
Sequence length 496
Comment pep:novel chromosome:BROADO5:4:402967846:402977654:-1 gene:ENSMODG00000011769 transcript:ENSMODT00000032126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQRFHTGEKHYQCNQCGKAFRNRSNLGKHQRIHTGKKPFECHQCGKSFTQSYNLAVHQRI
HTGEKPYQCNQCGKAFTHLATLAAHQRIHTGEKPYECHQCGKAFTESSAFAAHQRIHTGE
KPYECKQCGKAFTQRNNLAAHQRIHTGEKPYECKQCGKAFTQRNNLAAHQRIHTGEKPYQ
CNQCGKVFRQSSKLPAHQRTHTGEKPFQCNQCGKAFTQRGHLAAHQRIHTGEKPYECKQC
GKAFTDKSSNLVVHQRIHTGEKPFKCNQCGKAFTQRGNLASHQRIHTGEKPYQCNQCGKA
FTHMATLAAHQRTHTGEKPYQCNQCEKAFTDSSAFAAHQRIHTGEKPYKCNHCGKAFTQR
NNLAVHQRIHTGEKPYVCKQCGKAFTQRNNLAAHQRIHTGEKPYQCNQCGKVFRQSSKLP
AHQRTHTGEKPFQCNQCGKAFTQRGHLAAHERIHTGEKPYECKQCGKAFTDSSKLSTHQR
IHTGEKPYECNECGKT
Download sequence
Identical sequences F7C7W5
ENSMODP00000030555 13616.ENSMODP00000030555 ENSMODP00000030555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]